Прочетен: 2284 Коментари: 1 Гласове:
Последна промяна: 07.04.2010 13:26
Полската теменуга е плевел, който до сега е третиран с хербициди, но оттук насетне може да се окаже доходоносна суровина, която да се използва за направата на лекарство срещу рак. Почти всеки вид от род Виола съдържа циклотиди.
Някои виолетки имат неуловим мирис на цветя; заедно с терпените , основен компонент на аромата на теменужки е и кетонното съединение, наречено ionone , които временно обезчувствява рецепторите в носа;
Cyclotides са малки дисулфид богати пептиди изолирани от растения. Обикновено, съдържащи 28-37 амино киселини , които се характеризират с опашка към цикличния пептид и заключване разположено на трите си дисулфид облигации . Тези комбинирани функции са определени като цикличен цистин възел (CCK) мотив (Фигура 1). Към днешна дата над 100 cyclotides са били изолирани и се характеризира от вида на Брошови , Теменугови и Тиквови растителни семейства.
. Cyclotides имат точно определена триизмерна структура, като в резултат на техните заключващи облигационни дисулфиди и гръбнака на цикличния пептид. Опорна линии и избрани остатъци се носят от структура, която да помогне ориентацията. Една от интересните характеристики на цикличния пептиди е, че познаването на пептидната последователност не разкрива кодирането на главата и опашката; познаване на генната последователността е необходимо за това . В случай на kalata В1 посочените глицин (G) и аспарагин (N) аминокиселини са крайни остатъчни вещества, които са свързани в една пептид облигации на cyclise на пептид.
Биологичното значениеCyclotides са докладвани, че имат широк кръг от биологични дейности, включително за борба с ХИВ , унищожаване на насекомите , анти- тумор , противообрастващи, анти- микробни , хемолитична , neurotensin антагонизъм, трипсин инхибиране и утеротонично дейности. Една възможност за предизвикване на маточни контракции е това, което подтикна първоначално откриването на kalata В1. В мощни инсектицидни дейността на cyclotides kalata B1 и B2 kalata накара убеждението, че cyclotides действат като агенти за растителна защита (Фигура 2).Наблюденията, че десетки или повече cyclotides могат да присъстват в един завод и cyclotide архитектура се състои от запазени основните, върху която се показва серия от хипервариабилни вериги показват, че cyclotides може да бъде в състояние да се насочите много вредители / патогени едновременно.
Figure 2. Фигура 2. Ефектът от kalata В1 върху растежа и развитието на Helicoverpa punctigera, една гъсеница от ципокрили ред.
Cyclotide аминокиселини последователности
Анализ на пакет от известни cyclotides разкрива много хомоложни последователности, които са важни за разбирането на техните уникални физико-химични свойства и биоактивности. Таблица 1 представя селекция от cyclotides.
Сyclotides се делят на две основни структурни подсемейства. Мьобиус cyclotides , толкова по-обща от двете, съдържа цис-пролин в линия 5, които предизвикват местен 180 ° гръбнакът обрат (оттук и свързвайки го с една лента Мьобиус , докато гривна cyclotides не. има е по-малка промяна в последователността в рамките на тези подсемейства, отколкото между тях. Една трета от семействата cyclotides са трипсин инхибитори и са по-съответстващ на семейството на не-цикличния инхибитори трипсин от скуош растения, известни като knottins [9] , отколкото са другите cyclotides.
IТя е удобна за обсъждане на поредица от гледна точка на гръбнака сегменти, или примки, между две последователни цистеин остатъци. Шестте цистеин остатъци са абсолютно запазени целия cyclotide апартамент и вероятно допринася за опазването на CCK мотив. Въпреки че cysteines изглежда важно да се запази общата пъти, няколко други отпадъци, които са силно запазени в cyclotides се смята, че за осигуряване на допълнителни стабилност [10] .
По време на известни линия cyclotides 1 е най-запазени. Освен шестте цистеин остатъци, глутаминова киселина и серин / треонин остатъци от линията 1, са само остатъци да има 100% идентичност в гривна и Мьобиус подсемейства. Освен това останалите остатъчни вещества от тази линия показва само една консервативна промяна т.е. глицин / аланин . Този цикъл се смята, че играят важна роля за стабилизиране на cyclotide структура чрез водородни връзки с остатъци от линии 3 и 5. 2-6 линии също имат висока степен на консервирани характеристики, включително повсеместното наличие на само една аминокиселина в линия 4, която е вероятно свързани с водород sidechain-sidechain свързване. Други запазени остатъци включва хидроксилни, съдържащи остатъчни вещества в линия 3, остатък глицин в окончателната позиция на линия 3, основен и пролин остатъчни вещества в предпоследната позиция в линия 5 от гривна и Мьобиус cyclotides съответно и аспарагин (или от време на време нутриенти киселина ) остатъци на предполагаемото cyclisation точка в линия 6. Тя е от интерес да се отбележи, че не само са някои остатъци от силно запазени, но в основата и ъгли страна верига, както добре.
С последните програми за скрининг предполага, че броят на cyclotide поредицата скоро може да достигне хиляди [13] , една база данни, CyBase , е разработена, че дава възможност за сравнение на последователности и данните за дейността cyclotides. Several other families of circular proteins are known in bacteria, plants and animals and are also included in CyBase [ 14 ] . Няколко други семейства, с кръгло протеини са известни бактерии, растения и животни, и също са включени в CyBase [14] .
Table 1. Таблица 1. A selection of cyclotide sequences and sources Селекция от cyclotide последователността и източници
Биосинтез на cyclotides
Фигура 4. . Схематично представяне на cyclotide прекурсори Oak1 и Oak4 и предложи механизъм за биосинтеза [15] .
Растенията са богат източник на циклични пептиди, с по-голямата част от тези молекули да бъдат произведени чрез не-рибозомни биосинтез пътеки . За сметка на това циклотид гените са кодирани продукти, получени чрез преработката на големи предшественик протеин [2] . Генът за първото по рода си предшественик е Oak1 (Oldenlandia affinis kalata клонинг № 1), която е доказано, че са отговорни за синтеза на kalata В1 [11] . Фигура 4 илюстрира общи конфигурация на предшествениците протеини, които се състоят от една ендоплазматичния ретикулум поредица сигнали, които не са запазени в полза на региона, висока степен на консервиране регион, известен като N-терминал повторения (NTR), на зряла домейн cyclotide и накрая кратко хидрофобен C-терминал опашката. Домейнът cyclotide може да съдържа нито една последователност cyclotide, както в случая на Oak1 или няколко копия, разделени с допълнителни NTR последователности, както се вижда за Oak2 и Oak4. В предшественик протеини, съдържащи множество домейни cyclotide те могат или да бъдат всички еднакви последователности, както е случаят с Oak4, или те могат да бъдат различни cyclotides като в Oak2, който съдържа поредица, съответстващи на kalata B3 и B6.
Приложения Забележителната стабилност на cyclotides означава, че те са една вълнуваща гама от потенциалните приложения в центъра от двете им присъщите биологични дейности или на възможността за използване на CCK мотив като скеле за стабилизиране на биологично активни епитопи [16] . Интересът към тези последни интензивно с публикации на химични методология може да синтетично производство на cyclotides с високи добиви [17] , както и отговорност на CCK рамките на аминокиселини замествания [18] . Но за молекули, за да бъдат полезни в терапевтични настройка те изискват полезни биофармацевтични характеристики като резистентност към proteolysis и пропускливост мембрана.Освен това, ензимно разграждане на цистин наркотици възел пептид се свързва само с няколко протеази и те заявиха, че това ограничение може да бъде преодоляна чрез мутира на конкретни обекти разцепване.
Нови вещества изолирани във Виола Арвензис:
A new flavonoid di-C-glycoside, violarvensin (1), was isolated from the aerial parts of Viola arvensis, together with the known derivative violanthin (2). The structure of 1 was established as apigenin-6-C-β-d-glucopyranosyl-8-C-β-d-6-deoxygulopyranoside by spectral analysis.
J Biomol Screen. 2002 Aug ;7 (4):333-40 Selective cytotoxicity evaluation in anticancer drug screening of fractionated plant extracts. [My paper] Petra Lindholm, Joachim Gullbo, Per Claeson, Ulf Gцransson, Senia Johansson, Anders Backlund, Rolf Larsson, Lars Bohlin Division of Pharmacognosy, Department of Medicinal Chemistry, Biomedical Centre, Uppsala University, Uppsala, Sweden. Chosen to reflect biodiversity in a phylogenetic sense, 100 fractionated plant extracts were screened in vitro for cytotoxicity following extraction and fractionation (polypeptide isolation). Of these 100 extracts, 30 were selected and then characterized preliminarily for antitumor potency and mode of action by testing them on two cell lines and primary cultures of human tumor cells. On the basis of cytotoxicity potency, 10 of the extracts were further characterized for anticancer activity in 10 human tumor cell lines. This final testing resulted in seven potential lead plants with superior evidence of antitumor potential: Colchicum autumnale L.(Colchicaceae), Digitalis lanata Ehrh. and Digitalis purpurea L.(Plantaginaceae), Helleborus cyclophyllus Boiss.(Ranunculaceae), Menyanthes trifoliata L.(Menyanthaceae), and Viola arvensis Murr. and Viola patrinii Ging.(Violaceae). Within a database of antitumor compounds, the activity profiles of the extracts from these seven plants were compared, by correlation analysis, with those of more than 100 other compounds, including 39 standard drugs from different classes of cytotoxic mechanisms. The activity profiles of six of these candidates were uncorrelated with those of the standard drugs, possibly indicating new pathways of drug-mediated cell death.
Selective cytotoxicity evaluation in anticancer drug screening of fractionated plant extracts. [My paper] Petra Lindholm, Joachim Gullbo, Per Claeson, Ulf Gцransson, Senia Johansson, Anders Backlund, Rolf Larsson, Lars Bohlin
J Biomol Screen. 2002 Aug ;7 (4):333-40 Division of Pharmacognosy, Department of Medicinal Chemistry, Biomedical Centre, Uppsala University, Uppsala, Sweden. Chosen to reflect biodiversity in a phylogenetic sense, 100 fractionated plant extracts were screened in vitro for cytotoxicity following extraction and fractionation (polypeptide isolation). Of these 100 extracts, 30 were selected and then characterized preliminarily for antitumor potency and mode of action by testing them on two cell lines and primary cultures of human tumor cells. On the basis of cytotoxicity potency, 10 of the extracts were further characterized for anticancer activity in 10 human tumor cell lines. This final testing resulted in seven potential lead plants with superior evidence of antitumor potential: Colchicum autumnale L.(Colchicaceae), Digitalis lanata Ehrh. and Digitalis purpurea L.(Plantaginaceae), Helleborus cyclophyllus Boiss.(Ranunculaceae), Menyanthes trifoliata L.(Menyanthaceae), and Viola arvensis Murr. and Viola patrinii Ging.(Violaceae). Within a database of antitumor compounds, the activity profiles of the extracts from these seven plants were compared, by correlation analysis, with those of more than 100 other compounds, including 39 standard drugs from different classes of cytotoxic mechanisms. The activity profiles of six of these candidates were uncorrelated with those of the standard drugs, possibly indicating new pathways of drug-mediated cell death.
Seven novel macrocyclic polypeptides, designated as varv peptides B−H, have been isolated from the aerial parts of Viola arvensis. Their primary structures have been elucidated by automated Edman degradation and mass spectrometry. They all consist of 29 or 30 amino acid residues, covalently cyclized via the amide backbone and by three internal disulfide bridges. Their amino acid sequences are as follows: varv peptide B, cyclo-(TCFGGTCNTPGCSCDPWPMCSRNGLPVCGE); varv peptide C, cyclo-(TCVGGTCNTPGCSCSWPVCTRNGVPICGE); varv peptide D, cyclo-(TCVGGSCNTPGCSCSWPVCTRNGLPICGE); varv peptide E, cyclo-(TCVGGTCNTPGCSCSWPVCTRNGLPICGE); varv peptide F, cyclo-(TCTLGTCYTAGCSCSWPVCTRNGVPICGE); varv peptide G, cyclo-(TCFGGTCNTPGCSCDPWPVCSRNGVPVCGE); and varv peptide H, cyclo-(TCFGGTCNTPGCSCETWPVCSRNGLPVCGE). The varv peptides B−H exhibited high degrees of homology with the hitherto known macrocyclic peptides varv peptide A, kalata B1, violapeptide I, circulins A and B, and cyclopsychotride A.
Phylloquinone (Vitamin K1) Levels in Leaves of Plant Species Differing in Susceptibility to 2,4-Dichlorophenoxyacetic Acid OWE JANSSON 1 1 Institute of Botany, University of Stockholm, Lilla Frescati, S-104 05 Stockholm 50, Sweden Copyright 1974 Physiologia Plantarum ABSTRACT
 |
 |
Plant species differing in susceptibility to 2,4-dichlorophenoxyacetic acid (2,4-D) were examined as to the level of phylloquinone (K) in the leaves. The K level was found to be considerably higher in several plants resistant or moderately resistant to 2,4-D (Aegopodium podagraria L., Galium mollugo L., Lamium album L., Matricaria chamomilla L., Oxalis acetosella L., Stellaria media (L.) Vill., Viola arvensis Murr.) than in Chenopodium album L. and Sinapsis arvensis L. which are susceptible to 2,4-D. Capsella bursa-pastoris (L.) Med. and Plantago major L. (both moderately susceptible) and a few resistant or moderately resistant species (Agropyron repens (L.) PB., Anthriscus silvestris (L.) Hoffm., Triticum aestivum L.) had intermediate K levels. Cirsium arvense (L.) Scop. (susceptible) had a relatively high level of K. It is possible that a high K level in the plant can be of importance in the resistance to 2,4-D.
R. A. Bubenchikov1 and N. F. Goncharov1
Abstract HPLC analyses revealed 40 compounds of phenolic nature in field violet (Viola arvensis L.), which belong for the most part to the classes of flavonoids, coumarins, and phenolcarboxylic acid derivatives. Eleven compounds (luteolin, apigenin, quercetin, hyperoside, hesperidin, isoferulic acid, ferulic acid, ellagic acid, dicoumarin, catechol, and arbutin) have been identified in this plant for the first time.A fractionation protocol for the isolation of a highly purified polypeptide fraction from plant biomass is described. The procedure dereplicates ubiquitous substance classes known to interfere with bioassays often used in natural product-based drug discovery programs. The protocol involves pre-extraction with dichloromethane, extraction with ethanol (50%), removal of tannins with polyamide, removal of low-molecular-weight components with size-exclusion chromatography over Sephadex G-10, and final removal of salts and polysaccharides with solid-phase extraction using reversed-phase cartridges. The method has been applied to the aerial parts of Viola arvensis, resulting in the isolation of a peptide fraction that on further separation yielded a novel 29-residue macrocyclic polypeptide named varv peptide A, cyclo(-TCVGGTCNTPGCSCSWPVCTRNGLPVCGE-).
A crude fraction of Viola tricolor rich in small lipophilic proteins was prepared and subjected to fractionation guided by bioactivity, using RP-HPLC and a fluorometric cytotoxicity assay. Two human cancer cell lines, U-937 GTB (lymphoma) and RPMI-8226/s (myeloma), were used in this study. The most potent compounds isolated, that is, the compounds showing the lowest IC50 values, were shown to be three small proteins: vitri A (IC50 = 0.6 μM and IC50 = 1 μM, respectively), varv A (IC50 = 6 μM and IC50 = 3 μM, respectively), and varv E (IC50 = 4 μM in both cell lines). Their sequences, determined by automated Edman degradation, quantitative amino acid analysis, and mass spectrometry, were cyclo-GESCVWIPCITSAIGCSCKSKVCYRNGIPC (vitri A), cyclo-GETCVGGTCNTPGCSCSWPVCTRNGLPVC (varv A), and cyclo-GETCVGGTCNTPGCSCSWPVCTRNGLPIC (varv E), of which vitri A is described for the first time. Each forms a head-to-tail cyclic backbone, with six cysteine residues being involved in three disulfide bonds, characteristic of the family of small proteins called the cyclotides. This is the first report on cyclotides from the species V. tricolor and the first report on the sequence of the cytotoxic cyclotide vitri A.
The expression of cyclotides—macrocyclic plant peptides—was profiled in six violets, Viola cotyledon, V. biflora, V. arvensis, V. tricolor, V. riviniana, and V. odorata, by LC-MS. All were found to express notably complex mixtures, with single species containing >50 cyclotides. To facilitate their sequencing by MS-MS, an analytical strategy is presented involving aminoethylation of cysteines. This overcomes a number of problems intimately associated with the cyclotide core structure—that is, their joined N and C termini, disulfide knot, and low or clustered content of positively charged amino acids and enzymatic cleavage sites. As a result, charges as well as cleavage sites are introduced at the most conserved part of their sequence, the cysteines. Combined with tryptic digestion, all intercysteine loops are then of suitable size and charge for MS-MS sequencing. The utility of this strategy is shown by the sequencing of two novel cyclotides isolated from V. cotyledon; vico A (cyclo-(AESCVYIPCFTGIAGCSCKNKVCYYNGSIPC)) and vico B (cyclo-(AESCVYIPCITGIAGCSCKNKVCYYNGSIPC)); their complete sequence could be determined by nanospray MS-MS. The strategy for converting conserved cysteines to enzymatic cleavage sites might also benefit the study of other peptides and proteins displaying similar structural problems for MS analysis.
This review focuses on the discovery of cyclotides in the plant family Violaceae, their isolation and their anticancer effects. These macrocyclic plant peptides consist of about 30 amino acids, including three conserved disulfide bonds in a cystine knotted arrangement, which renders them a remarkable stability. Their unique structure, combined with a wide array of biological activities, makes them of great interest as possible leads in drug development or as carriers of grafted peptide sequences. Here we describe the work conducted in our laboratory, which started with the overall aim of identifying peptides and small proteins of the size 10-50 amino acid residues in plants with novel chemical structures and biological profiles with a potential for drug development or for use as pharmacological tools. Thus we developed a fractionation protocol to directly address major challenges encountered when dealing with plant material, such as removal of chlorophyll, polyphenols, and low molecular compounds omnipresent in plants. Using this protocol, we then discovered a suite of cyclotides, the varv peptides, from the plant Viola arvensis (Violaceae). Following this, separation methods directly targeting cyclotides were developed, e.g. by adsorption, ion exchange chromatography and solventsolvent partitioning, which then were used in the isolation of additional cyclotides. To structurally examine cyclotides we have also developed methods based on mass spectrometry for cyclotide sequencing and mapping of disulfide bonds. Finally, to assess structure-activity relationships, regarding their anti-cancer and cytotoxic effects that we focus upon, we have also characterized the three dimensional structure of cyclotides by homology modeling techniques.
